SCOPe 2.04: Domain d4u21b_: 4u21 B:

Lineage for d4u21b_ (4u21 B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.1: Phosphate binding protein-like [53851] (42 proteins)

6. Protein Glutamate receptor ligand binding core [53881] (5 species)

7. Species Norway rat (Rattus norvegicus), GluR2 [TaxId:10116] [53882] (124 PDB entries)

8. Domain d4u21b_: 4u21 B: [259117]
   automated match to d4fata_
   complexed with fwd, fwf

Details for d4u21b_

PDB Entry: 4u21, 1.39 Å

PDB Description: glua2flip slbd complexed with fw and (r,r)-2b crystal form e

PDB Compounds: (B:) Glutamate receptor 2,Glutamate receptor 2

SCOPe Domain Sequences for d4u21b_:

Sequence; same for both SEQRES and ATOM records:

>d4u21b_ c.94.1.1 (B:) Glutamate receptor ligand binding core {Norway rat (Rattus norvegicus), GluR2 [TaxId: 10116]}
nktvvvttilespyvmmkknhemlegneryegycvdlaaeiakhcgfkykltivgdgkyg
ardadtkiwngmvgelvygkadiaiapltitlvreevidfskpfmslgisimikkgtpie
saedlskqteiaygtldsgstkeffrrskiavfdkmwtymrsaepsvfvrttaegvarvr
kskgkyayllestmneyieqrkpcdtmkvggnldskgygiatpkgsslgtpvnlavlkls
eqgvldklknkwwydkgecg

Timeline for d4u21b_:

• d4u21b_ is new in SCOPe 2.04-stable
  
• d4u21b_ appears in SCOPe 2.05
  
• d4u21b_ appears in the current release, SCOPe 2.08