SCOPe 2.06: Domain d4qppc_: 4qpp C:

Lineage for d4qppc_ (4qpp C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest

4. Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families)

5. Family c.66.1.0: automated matches [191451] (1 protein)
   not a true family

6. Protein automated matches [190689] (64 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187871] (15 PDB entries)

8. Domain d4qppc_: 4qpp C: [259104]
   automated match to d4hc4a_
   complexed with 36s, sah

Details for d4qppc_

PDB Entry: 4qpp, 2.52 Å

PDB Description: the crystal structure of human hmt1 hnrnp methyltransferase-like protein 6 in complex with compound ds-421 (2-{4-[3-chloro-2-(2- methoxyphenyl)-1h-indol-5-yl]piperidin-1-yl}-n-methylethanamine

PDB Compounds: (C:) Protein arginine N-methyltransferase 6

SCOPe Domain Sequences for d4qppc_:

Sequence; same for both SEQRES and ATOM records:

>d4qppc_ c.66.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yyecysdvsvheemiadrvrtdayrlgilrnwaalrgktvldvgagtgilsifcaqagar
rvyaveasaiwqqarevvrfngledrvhvlpgpvetvelpeqvdaivsewmgygllhesm
lssvlhartkwlkegglllpasaelfivpisdqmlewrlgfwsqvkqhygvdmsclegfa
trclmghseivvqglsgedvlarpqrfaqlelsragleqeleagvggrfrcscygsapmh
gfaiwfqvtfpggesekplvlstspfhpathwkqallylnepvqveqdtdvsgeitllps
rdnprrlrvllrykvgdqeektkdfame

Timeline for d4qppc_:

• d4qppc_ first appeared in SCOPe 2.04
  
• d4qppc_ appears in SCOPe 2.05
  
• d4qppc_ appears in SCOPe 2.07
  
• d4qppc_ appears in the current release, SCOPe 2.08