SCOPe 2.05: Domain d4pv1f_: 4pv1 F:

Lineage for d4pv1f_ (4pv1 F:)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (40 superfamilies)
   not a true fold

4. Superfamily f.23.25: PetM subunit of the cytochrome b6f complex [103441] (1 family)

5. Family f.23.25.1: PetM subunit of the cytochrome b6f complex [103442] (2 proteins)

6. Protein PetM subunit of the cytochrome b6f complex [103443] (2 species)

7. Species Mastigocladus laminosus [TaxId:83541] [103444] (8 PDB entries)

8. Domain d4pv1f_: 4pv1 F: [259094]
   Other proteins in same PDB: d4pv1a_, d4pv1b_, d4pv1d1, d4pv1d2, d4pv1e_, d4pv1g_, d4pv1h_
   automated match to d1vf5s_
   complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, opc, sma, sqd, umq

Details for d4pv1f_

PDB Entry: 4pv1, 3 Å

PDB Description: cytochrome b6f structure from m. laminosus with the quinone analog inhibitor stigmatellin

PDB Compounds: (F:) Cytochrome b6-f complex subunit 7

SCOPe Domain Sequences for d4pv1f_:

Sequence; same for both SEQRES and ATOM records:

>d4pv1f_ f.23.25.1 (F:) PetM subunit of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
teemlyaallsfglifvgwglgvlllkiqga

Timeline for d4pv1f_:

• d4pv1f_ first appeared in SCOPe 2.04
  
• d4pv1f_ appears in SCOPe 2.06
  
• d4pv1f_ appears in the current release, SCOPe 2.08