Lineage for d4pv1b_ (4pv1 B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633244Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 2633245Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 2633246Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2633293Protein Subunit IV of the cytochrome b6f complex [103495] (2 species)
  7. 2633296Species Mastigocladus laminosus [TaxId:83541] [103496] (8 PDB entries)
  8. 2633299Domain d4pv1b_: 4pv1 B: [259090]
    Other proteins in same PDB: d4pv1a_, d4pv1d1, d4pv1d2, d4pv1e_, d4pv1f_, d4pv1g_, d4pv1h_
    automated match to d2e74b1
    complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, opc, sma, sqd, umq

Details for d4pv1b_

PDB Entry: 4pv1 (more details), 3 Å

PDB Description: cytochrome b6f structure from m. laminosus with the quinone analog inhibitor stigmatellin
PDB Compounds: (B:) Cytochrome b6-f complex subunit 4

SCOPe Domain Sequences for d4pv1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pv1b_ f.32.1.1 (B:) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]}
atlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpam
vgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkfq
npfrrpvattiflfgtlvtiwlgigatfpldktltlglf

SCOPe Domain Coordinates for d4pv1b_:

Click to download the PDB-style file with coordinates for d4pv1b_.
(The format of our PDB-style files is described here.)

Timeline for d4pv1b_: