Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) |
Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (3 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
Protein Subunit IV of the cytochrome b6f complex [103495] (2 species) |
Species Mastigocladus laminosus [TaxId:83541] [103496] (8 PDB entries) |
Domain d4pv1b_: 4pv1 B: [259090] Other proteins in same PDB: d4pv1a_, d4pv1d1, d4pv1d2, d4pv1e_, d4pv1f_, d4pv1g_, d4pv1h_ automated match to d2e74b1 complexed with 7ph, 8k6, bcr, cd, cla, fes, hem, mys, opc, sma, sqd, umq |
PDB Entry: 4pv1 (more details), 3 Å
SCOPe Domain Sequences for d4pv1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pv1b_ f.32.1.1 (B:) Subunit IV of the cytochrome b6f complex {Mastigocladus laminosus [TaxId: 83541]} atlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpam vgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkfq npfrrpvattiflfgtlvtiwlgigatfpldktltlglf
Timeline for d4pv1b_: