Class a: All alpha proteins [46456] (286 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.0: automated matches [191396] (1 protein) not a true family |
Protein automated matches [190513] (27 species) not a true protein |
Species Atlantic cod (Gadus morhua) [TaxId:8049] [259070] (1 PDB entry) |
Domain d2mbxa_: 2mbx A: [259071] automated match to d1ttxa_ complexed with ca |
PDB Entry: 2mbx (more details)
SCOPe Domain Sequences for d2mbxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mbxa_ a.39.1.0 (A:) automated matches {Atlantic cod (Gadus morhua) [TaxId: 8049]} mafagilndaditaalaackaegsfdhkafftkvglaakspadikkvfeiidqdksdfve edelklflqnfsagaralsdaetkvflkagdsdgdgkigvdefgamika
Timeline for d2mbxa_: