![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein automated matches [190041] (24 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [259060] (4 PDB entries) |
![]() | Domain d4cvpa_: 4cvp A: [259062] automated match to d3e1ja_ complexed with fe |
PDB Entry: 4cvp (more details), 2.11 Å
SCOPe Domain Sequences for d4cvpa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4cvpa_ a.25.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} amkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyresidemkhadryi erilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvrdyvsrdm mieilrdeeghidwleteldliqkmglqnylqaqi
Timeline for d4cvpa_: