Lineage for d4cvta_ (4cvt A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1485319Protein automated matches [190041] (24 species)
    not a true protein
  7. 1485497Species Escherichia coli [TaxId:562] [259060] (4 PDB entries)
  8. 1485500Domain d4cvta_: 4cvt A: [259061]
    automated match to d3e1ja_
    complexed with zn

Details for d4cvta_

PDB Entry: 4cvt (more details), 1.79 Å

PDB Description: Structure of Apobacterioferritin Y58F variant
PDB Compounds: (A:) bacterioferritin

SCOPe Domain Sequences for d4cvta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4cvta_ a.25.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
amkgdtkvinylnkllgnelvainqyflharmfknwglkrlndveyresidemkhadrfi
erilfleglpnlqdlgklnigedveemlrsdlaleldgaknlreaigyadsvrdyvsrdm
mieilrdeeghidwleteldliqkmglqnylqaqire

SCOPe Domain Coordinates for d4cvta_:

Click to download the PDB-style file with coordinates for d4cvta_.
(The format of our PDB-style files is described here.)

Timeline for d4cvta_:

  • d4cvta_ appears in periodic updates to SCOPe 2.04 starting on 2014-08-23
  • d4cvta_ appears in SCOPe 2.05
  • d4cvta_ appears in the current release, SCOPe 2.07, called d4cvta1