SCOPe 2.04: Domain d3wtya_: 3wty A:

Lineage for d3wtya_ (3wty A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.6: RUNT domain [81318] (2 proteins)
   automatically mapped to Pfam PF00853

6. Protein automated matches [190872] (1 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188223] (6 PDB entries)

8. Domain d3wtya_: 3wty A: [259051]
   Other proteins in same PDB: d3wtyc_
   automated match to d1hjbc_
   protein/DNA complex

Details for d3wtya_

PDB Entry: 3wty, 2.7 Å

PDB Description: crystal structure of the complex comprised of ets1(g333p), runx1, cbfbeta, and the tcralpha gene enhancer dna

PDB Compounds: (A:) runt-related transcription factor 1

SCOPe Domain Sequences for d3wtya_:

Sequence; same for both SEQRES and ATOM records:

>d3wtya_ b.2.5.6 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gelvrtdspnflcsvlpthwrcnktlpiafkvvakgdvpdgtlvtvmagndenysaelrn
ataamknqvarfndlrfvgrsgrgksftltitvftnppqvatyhraikitvdgprepr

Timeline for d3wtya_:

• d3wtya_ is new in SCOPe 2.04-stable
  
• d3wtya_ appears in SCOPe 2.05
  
• d3wtya_ appears in the current release, SCOPe 2.08