SCOPe 2.04: Domain d4unze_: 4unz E:

Lineage for d4unze_ (4unz E:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.19: Viral protein domain [49817] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll; form trimers

4. Superfamily b.19.1: Viral protein domain [49818] (4 families)
   forms homotrimers

5. Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)

6. Protein automated matches [190291] (23 species)
   not a true protein

7. Species Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId:159470] [258548] (2 PDB entries)

8. Domain d4unze_: 4unz E: [259035]
   Other proteins in same PDB: d4unzf_
   automated match to d3hmga_
   complexed with nag

Details for d4unze_

PDB Entry: 4unz, 2.9 Å

PDB Description: structure of the a_equine_newmarket_2_93 h3 haemagglutinin in complex with 6so4-sialyl lewis x

PDB Compounds: (E:) hay subunit of haemagglutinin

SCOPe Domain Sequences for d4unze_:

Sequence; same for both SEQRES and ATOM records:

>d4unze_ b.19.1.2 (E:) automated matches {Influenza a virus (a/eq/newmarket/93/(h3n8)) [TaxId: 159470]}
nntatlclghhavangtlvktitddqievtnatelvqsisigkicnnsyrvldgrnctli
damlgdphcddfqyenwdlfierssafsncypydipdyaslrsivassgtleftaegftw
tgvtqnggsgackrgsadsffsrlnwltksgnsypilnvtmpnnknfdklyiwgihhpss
nkeqtklyiqesgrvtvstersqqtvipnigsrpwvrgqsgrisiywtivkpgdilmins
ngnlvaprgyfklrtgkssvmrsdalidtcvsecitpngsipndkpfqnvnkitygkcpk
yirqntlklatgmrnvpe

Timeline for d4unze_:

• d4unze_ is new in SCOPe 2.04-stable
  
• d4unze_ appears in SCOPe 2.05
  
• d4unze_ appears in the current release, SCOPe 2.08