Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) N-terminal residue provides two catalytic groups, nucleophile and proton donor |
Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
Protein automated matches [190144] (7 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (41 PDB entries) |
Domain d4r02q_: 4r02 Q: [259015] Other proteins in same PDB: d4r02a_, d4r02e_, d4r02g_, d4r02i_, d4r02j_, d4r02k_, d4r02l_, d4r02n_, d4r02o_, d4r02s_, d4r02u_, d4r02w_, d4r02x_, d4r02y_, d4r02z_ automated match to d1rypd_ complexed with 3e5, mg |
PDB Entry: 4r02 (more details), 2.5 Å
SCOPe Domain Sequences for d4r02q_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4r02q_ d.153.1.4 (Q:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]} gydralsifspdghifqveyaleavkrgtcavgvkgkncvvlgcerrstlklqdtritps kvskidshvvlsfsglnadsriliekarveaqshrltledpvtveyltryvagvqqrytq sggvrpfgvstliagfdprddepklyqtepsgiysswsaqtigrnsktvrefleknydrk eppatveecvkltvrsllevvqtgaknieitvvkpdsdivalsseeinqyvtqieqekqe
Timeline for d4r02q_: