SCOPe 2.05: Domain d4r02g_: 4r02 G:

Lineage for d4r02g_ (4r02 G:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (7 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (76 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d4r02g_: 4r02 G: [259009]
   Other proteins in same PDB: d4r02a_, d4r02b_, d4r02c_, d4r02d_, d4r02f_, d4r02h_, d4r02i_, d4r02j_, d4r02k_, d4r02l_, d4r02m_, d4r02n_, d4r02o_, d4r02p_, d4r02q_, d4r02r_, d4r02t_, d4r02v_, d4r02w_, d4r02x_, d4r02y_, d4r02z_
   automated match to d1g0ug_
   complexed with 3e5, mg

Details for d4r02g_

PDB Entry: 4r02, 2.5 Å

PDB Description: yCP in complex with BSc4999 (alpha-Keto Phenylamide)

PDB Compounds: (G:) Proteasome subunit alpha type-1

SCOPe Domain Sequences for d4r02g_:

Sequence; same for both SEQRES and ATOM records:

>d4r02g_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttvs
yifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiytq
raymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkksk
idhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaiae
q

Timeline for d4r02g_:

• d4r02g_ first appeared in SCOPe 2.04
  
• d4r02g_ appears in SCOPe 2.06
  
• d4r02g_ appears in the current release, SCOPe 2.08