Lineage for d4r02f_ (4r02 F:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676433Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1676434Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1676603Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1678261Protein automated matches [190144] (7 species)
    not a true protein
  7. 1678524Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [189752] (31 PDB entries)
  8. 1678555Domain d4r02f_: 4r02 F: [259008]
    Other proteins in same PDB: d4r02a_, d4r02e_, d4r02g_, d4r02i_, d4r02j_, d4r02k_, d4r02l_, d4r02n_, d4r02o_, d4r02u_, d4r02w_, d4r02x_, d4r02y_, d4r02z_
    automated match to d4g4sg_
    complexed with 3e5, mg

Details for d4r02f_

PDB Entry: 4r02 (more details), 2.5 Å

PDB Description: yCP in complex with BSc4999 (alpha-Keto Phenylamide)
PDB Compounds: (F:) probable proteasome subunit alpha type-7

SCOPe Domain Sequences for d4r02f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4r02f_ d.153.1.4 (F:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
tgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqknv
kiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqahtl
ynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhpe
glsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaqk
ein

SCOPe Domain Coordinates for d4r02f_:

Click to download the PDB-style file with coordinates for d4r02f_.
(The format of our PDB-style files is described here.)

Timeline for d4r02f_: