![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.77: beta-Prism I [51091] (3 superfamilies) consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis duplication: has internal pseudo threefold symmetry |
![]() | Superfamily b.77.2: delta-Endotoxin (insectocide), middle domain [51096] (2 families) ![]() |
![]() | Family b.77.2.0: automated matches [254290] (1 protein) not a true family |
![]() | Protein automated matches [254673] (3 species) not a true protein |
![]() | Species Bacillus thuringiensis [TaxId:1444] [258996] (4 PDB entries) |
![]() | Domain d4qx2a2: 4qx2 A:290-499 [258997] Other proteins in same PDB: d4qx2a1, d4qx2a3 automated match to d1dlca2 |
PDB Entry: 4qx2 (more details), 2.9 Å
SCOPe Domain Sequences for d4qx2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qx2a2 b.77.2.0 (A:290-499) automated matches {Bacillus thuringiensis [TaxId: 1444]} lypkevkteltrdvltdpivgvnnlrgygttfsnienyirkphlfdylhriqfhtrfqpg yygndsfnywsgnyvstrpsigsndiitspfygnkssepvqnlefngekvyravantnla vwpsavysgvtkvefsqyndqtdeastqtydskrnvgavswdsidqlppettdeplekgy shqlnyvmcflmqgsrgtipvltwthksvd
Timeline for d4qx2a2: