SCOPe 2.04: Domain d4qsea_: 4qse A:

Lineage for d4qsea_ (4qse A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (87 species)
   not a true protein

7. Species Agrobacterium fabrum [TaxId:176299] [258501] (4 PDB entries)

8. Domain d4qsea_: 4qse A: [258993]
   automated match to d1fqba_
   complexed with gol

Details for d4qsea_

PDB Entry: 4qse, 1.37 Å

PDB Description: crystal structure of atu4361 sugar transporter from agrobacterium fabrum c58, target efi-510558, with bound glycerol

PDB Compounds: (A:) abc-type sugar transporter

SCOPe Domain Sequences for d4qsea_:

Sequence; same for both SEQRES and ATOM records:

>d4qsea_ c.94.1.0 (A:) automated matches {Agrobacterium fabrum [TaxId: 176299]}
dvtltlwsldrdiqpapnlikefnalnngikieyrqlqfddvvsesmraystgnapdiia
idnpnhamfasrgafldvtdmiaksdviktenyfpgplksvtwdgkyfgvpkatntialy
ynkdlfkaagldaakppqtwdelvdaarkltnpaknvygisfsakaneegtfqflpwaqm
agatyknintdgavkaletwktlldeklaspdtltrsqwdstatfnagnaamaisgpwei
drmlkdakfdwgvtllpvptpdaprssamgdynwaifsktkhpaeafkaieffaskdkdm
fknfgqlparsdipvpptgnalkdealktfveqlkyaqprgpspewpkiskaiqdaiqga
lsgqmtpkaaldqaaekiklvd

Timeline for d4qsea_:

• d4qsea_ is new in SCOPe 2.04-stable
  
• d4qsea_ appears in SCOPe 2.05
  
• d4qsea_ appears in the current release, SCOPe 2.08