SCOPe 2.05: Domain d4okhc_: 4okh C:

Lineage for d4okhc_ (4okh C:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.0: automated matches [191396] (1 protein)
   not a true family

6. Protein automated matches [190513] (27 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189519] (38 PDB entries)

8. Domain d4okhc_: 4okh C: [258956]
   automated match to d1kfxs_
   complexed with ca, peu

Details for d4okhc_

PDB Entry: 4okh, 2.45 Å

PDB Description: crystal structure of calpain-3 penta-ef-hand domain

PDB Compounds: (C:) Calpain-3

SCOPe Domain Sequences for d4okhc_:

Sequence, based on SEQRES records:

>d4okhc_ a.39.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmeicadelkkvlntvvnkhkdlkthgftlescrsmialmdtdgsgklnlqefhhlwnki
kawqkifkhydtdqsgtinsyemrnavndagfhlnnqlydiitmryadkhmnidfdsfic
cfvrlegmfrafhafdkdgdgiiklnvlewlqltm

Sequence, based on observed residues (ATOM records):

>d4okhc_ a.39.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dmeicadelkkvlntvvhgftlescrsmialmdtdgsgklnlqefhhlwnkikawqkifk
hydtdqsgtinsyemrnavndagfhlnnqlydiitmryadkhmnidfdsficcfvrlegm
frafhafdkdgdgiiklnvlewlqltm

Timeline for d4okhc_:

• d4okhc_ first appeared in SCOPe 2.04
  
• d4okhc_ appears in SCOPe 2.06
  
• d4okhc_ appears in the current release, SCOPe 2.08