Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) |
Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
Protein Uracil-DNA glycosylase [52143] (5 species) |
Species Atlantic cod (Gadus morhua) [TaxId:8049] [102212] (2 PDB entries) |
Domain d4lylg_: 4lyl G: [258931] Other proteins in same PDB: d4lylb_, d4lyld_, d4lylf_, d4lylh_, d4lylj_, d4lyll_, d4lyln_, d4lylp_ automated match to d1okba_ protein/DNA complex |
PDB Entry: 4lyl (more details), 1.93 Å
SCOPe Domain Sequences for d4lylg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4lylg_ c.18.1.1 (G:) Uracil-DNA glycosylase {Atlantic cod (Gadus morhua) [TaxId: 8049]} meffgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvi lgqdpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvl llnavltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrh hvlqavhpsplsahrgflgckhfskangllklsgtepinwral
Timeline for d4lylg_: