SCOPe 2.06: Domain d4lylc1: 4lyl C:85-304

Lineage for d4lylc1 (4lyl C:85-304)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein Uracil-DNA glycosylase [52143] (5 species)

7. Species Atlantic cod (Gadus morhua) [TaxId:8049] [102212] (2 PDB entries)

8. Domain d4lylc1: 4lyl C:85-304 [258926]
   Other proteins in same PDB: d4lyla2, d4lylb_, d4lylc2, d4lyld_, d4lyle2, d4lylf_, d4lylg2, d4lylh_, d4lyli2, d4lylj_, d4lylk2, d4lyll_, d4lylm2, d4lyln_, d4lylo2, d4lylp_
   automated match to d1okba_
   protein/DNA complex

Details for d4lylc1

PDB Entry: 4lyl, 1.93 Å

PDB Description: Crystal structure of uracil-DNA glycosylase from cod (Gadus morhua) in complex with the proteinaceous inhibitor UGI

PDB Compounds: (C:) uracil-DNA glycosylase

SCOPe Domain Sequences for d4lylc1:

Sequence; same for both SEQRES and ATOM records:

>d4lylc1 c.18.1.1 (C:85-304) Uracil-DNA glycosylase {Atlantic cod (Gadus morhua) [TaxId: 8049]}
fgetwrrelaaefekpyfkqlmsfvadersrhtvyppadqvyswtemcdiqdvkvvilgq
dpyhgpnqahglcfsvqkpvppppslvniykelctdidgfkhpghgdlsgwakqgvllln
avltvrahqanshkdrgwetftdavikwlsvnregvvfllwgsyahkkgatidrkrhhvl
qavhpsplsahrgflgckhfskangllklsgtepinwral

Timeline for d4lylc1:

• d4lylc1 first appeared in SCOPe 2.04, called d4lylc_
  
• d4lylc1 was called d4lylc_ in SCOPe 2.05
  
• d4lylc1 appears in SCOPe 2.07
  
• d4lylc1 appears in the current release, SCOPe 2.08