Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (19 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries) |
Domain d4bz1l1: 4bz1 L:1-113 [258893] Other proteins in same PDB: d4bz1a_, d4bz1l2 automated match to d2fd6l1 complexed with cl, gol, na, zn |
PDB Entry: 4bz1 (more details), 2.15 Å
SCOPe Domain Sequences for d4bz1l1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4bz1l1 b.1.1.0 (L:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divmsqspsslavsvgekvtlsckssqsllyssnqknhlawyqqkpgqspklliywastr esgvpdrftgsgsgtdftltinsvkaedlavyycqhfyiypytfgggtkleik
Timeline for d4bz1l1: