Lineage for d4bz2l1 (4bz2 L:1-107)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1510242Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1512732Protein automated matches [190119] (19 species)
    not a true protein
  7. 1513189Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)
  8. 1513282Domain d4bz2l1: 4bz2 L:1-107 [258891]
    Other proteins in same PDB: d4bz2a_, d4bz2l2
    automated match to d1boga1
    complexed with cl, gol, na, peg

Details for d4bz2l1

PDB Entry: 4bz2 (more details), 2.03 Å

PDB Description: Structure of dengue virus EDIII in complex with Fab 2D73
PDB Compounds: (L:) fab 2d73 light chain

SCOPe Domain Sequences for d4bz2l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bz2l1 b.1.1.1 (L:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dikmtqspssmyaslgervtitckasqginsdlswfqqkpgkspktliyranrlvdgvps
rfsgsgsgqdysltissleyedmgiyyclqydefpltfgagtklelk

SCOPe Domain Coordinates for d4bz2l1:

Click to download the PDB-style file with coordinates for d4bz2l1.
(The format of our PDB-style files is described here.)

Timeline for d4bz2l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4bz2l2
View in 3D
Domains from other chains:
(mouse over for more information)
d4bz2a_