Lineage for d4bz2a_ (4bz2 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1523789Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1524658Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1524659Protein automated matches [190226] (39 species)
    not a true protein
  7. 1524709Species Dengue virus 4 [TaxId:11070] [195988] (4 PDB entries)
  8. 1524711Domain d4bz2a_: 4bz2 A: [258887]
    Other proteins in same PDB: d4bz2l1, d4bz2l2
    automated match to d4am0s_
    complexed with cl, gol, na, peg

Details for d4bz2a_

PDB Entry: 4bz2 (more details), 2.03 Å

PDB Description: Structure of dengue virus EDIII in complex with Fab 2D73
PDB Compounds: (A:) envelope protein

SCOPe Domain Sequences for d4bz2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4bz2a_ b.1.18.0 (A:) automated matches {Dengue virus 4 [TaxId: 11070]}
vefkrmcsgkfsidkemaetqhgttvvkvkyegagapckvpieirdvnkekvvgriisst
pfaeytnsvtnieleppfgdsyivigvgdsaltlhwfrkhh

SCOPe Domain Coordinates for d4bz2a_:

Click to download the PDB-style file with coordinates for d4bz2a_.
(The format of our PDB-style files is described here.)

Timeline for d4bz2a_:

  • d4bz2a_ appears in periodic updates to SCOPe 2.04 starting on 2014-08-13
  • d4bz2a_ appears in SCOPe 2.05
  • d4bz2a_ appears in the current release, SCOPe 2.07, called d4bz2a1