SCOPe 2.04: Domain d3wfxa_: 3wfx A:

Lineage for d3wfxa_ (3wfx A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.0: automated matches [191420] (1 protein)
   not a true family

6. Protein automated matches [190590] (15 species)
   not a true protein

7. Species Methylacidiphilum infernorum [TaxId:481448] [195689] (5 PDB entries)

8. Domain d3wfxa_: 3wfx A: [258875]
   automated match to d2gdma_
   complexed with hem, hez, imd

Details for d3wfxa_

PDB Entry: 3wfx, 1.94 Å

PDB Description: crystal structure of the imidazole-bound form of the hgbrl's globin domain

PDB Compounds: (A:) Hemoglobin-like flavoprotein fused to Roadblock/LC7 domain

SCOPe Domain Sequences for d3wfxa_:

Sequence; same for both SEQRES and ATOM records:

>d3wfxa_ a.1.1.0 (A:) automated matches {Methylacidiphilum infernorum [TaxId: 481448]}
mtreeikmiqkswlrvidkmdeagllfyrrlfdvepkvrplfkidiekqgrklmdvlnwi
vlnlqdidaaldaarelarrhvkygvkaehypvvghtliwtlrkmigsewtkqleqlwtq
ayealaqvmieehhhh

Timeline for d3wfxa_:

• d3wfxa_ is new in SCOPe 2.04-stable
  
• d3wfxa_ appears in SCOPe 2.05
  
• d3wfxa_ appears in the current release, SCOPe 2.08, called d3wfxa1