Class a: All alpha proteins [46456] (285 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.0: automated matches [191420] (1 protein) not a true family |
Protein automated matches [190590] (15 species) not a true protein |
Species Lamellibrachia satsuma [TaxId:104711] [256471] (4 PDB entries) |
Domain d3wcuf_: 3wcu F: [258871] automated match to d1x9fb_ complexed with ca, hem |
PDB Entry: 3wcu (more details), 2.9 Å
SCOPe Domain Sequences for d3wcuf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wcuf_ a.1.1.0 (F:) automated matches {Lamellibrachia satsuma [TaxId: 104711]} secgplqrlkvkrqwaeaygsgngreefghfiwanvfkvapsardmfkrvrgdniytpaf rahatrvlggldmcvallddesvlntqlahlasqhssrgvsaeqynvvehavmmgvehei gqnvfdkdawqacldvitsgiqgn
Timeline for d3wcuf_: