Lineage for d3wcuf_ (3wcu F:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1475749Family a.1.1.0: automated matches [191420] (1 protein)
    not a true family
  6. 1475750Protein automated matches [190590] (15 species)
    not a true protein
  7. 1475781Species Lamellibrachia satsuma [TaxId:104711] [256471] (4 PDB entries)
  8. 1475809Domain d3wcuf_: 3wcu F: [258871]
    automated match to d1x9fb_
    complexed with ca, hem

Details for d3wcuf_

PDB Entry: 3wcu (more details), 2.9 Å

PDB Description: the structure of a deoxygenated 400 kda hemoglobin provides a more accurate description of the cooperative mechanism of giant hemoglobins: deoxygenated form
PDB Compounds: (F:) A2 globin chain of giant V2 hemoglobin

SCOPe Domain Sequences for d3wcuf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wcuf_ a.1.1.0 (F:) automated matches {Lamellibrachia satsuma [TaxId: 104711]}
secgplqrlkvkrqwaeaygsgngreefghfiwanvfkvapsardmfkrvrgdniytpaf
rahatrvlggldmcvallddesvlntqlahlasqhssrgvsaeqynvvehavmmgvehei
gqnvfdkdawqacldvitsgiqgn

SCOPe Domain Coordinates for d3wcuf_:

Click to download the PDB-style file with coordinates for d3wcuf_.
(The format of our PDB-style files is described here.)

Timeline for d3wcuf_: