SCOPe 2.05: Domain d4u6hd2: 4u6h D:113-218

Lineage for d4u6hd2 (4u6h D:113-218)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d4u6hd2: 4u6h D:113-218 [258844]
   Other proteins in same PDB: d4u6hb1, d4u6hd1
   automated match to d1t66c2

Details for d4u6hd2

PDB Entry: 4u6h, 3.1 Å

PDB Description: vaccinia l1/m12b9-fab complex

PDB Compounds: (D:) Light chain of murine anti-vaccinia L1 IgG2a antibody M12B9

SCOPe Domain Sequences for d4u6hd2:

Sequence; same for both SEQRES and ATOM records:

>d4u6hd2 b.1.1.2 (D:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrne

Timeline for d4u6hd2:

• d4u6hd2 first appeared in SCOPe 2.04
  
• d4u6hd2 appears in SCOPe 2.06
  
• d4u6hd2 appears in the current release, SCOPe 2.08