SCOPe 2.08: Domain d4u6hb1: 4u6h B:1-112

Lineage for d4u6hb1 (4u6h B:1-112)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
Protein automated matches [190119] (24 species)
not a true protein
Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
Domain d4u6hb1: 4u6h B:1-112 [258841]
Other proteins in same PDB: d4u6ha2, d4u6hb2, d4u6hc2, d4u6hd2
automated match to d1t66c1

Details for d4u6hb1

PDB Entry: 4u6h (more details), 3.1 Å

PDB Description: vaccinia l1/m12b9-fab complex

PDB Compounds: (B:) Light chain of murine anti-vaccinia L1 IgG2a antibody M12B9

SCOPe Domain Sequences for d4u6hb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4u6hb1 b.1.1.1 (B:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqiplslpvslgdqasiscrssqslvhsngntylhwslqkpgqspnlliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthdpwtfgggtkleik

SCOPe Domain Coordinates for d4u6hb1:

Click to download the PDB-style file with coordinates for d4u6hb1.
(The format of our PDB-style files is described here.)

Timeline for d4u6hb1: