Lineage for d4tx6a_ (4tx6 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1818156Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 1820295Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 1820296Protein automated matches [190075] (72 species)
    not a true protein
  7. 1820318Species Aspergillus fumigatus [TaxId:451804] [189778] (3 PDB entries)
  8. 1820321Domain d4tx6a_: 4tx6 A: [258828]
    automated match to d2xtkb_
    complexed with 38b, po4

Details for d4tx6a_

PDB Entry: 4tx6 (more details), 1.9 Å

PDB Description: AfChiA1 in complex with compound 1
PDB Compounds: (A:) class III chitinase chia1

SCOPe Domain Sequences for d4tx6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tx6a_ c.1.8.0 (A:) automated matches {Aspergillus fumigatus [TaxId: 451804]}
snlaiywgqgpnqlrlshfcqetsldiinigfinyfpdmspghwpgsnfgnqcdgsvyvt
ndgvvtkllsgchqimedipicqaagkkvllsiggayppdqsilsedsavafatflwgaf
gpvaegwegprpfgdvvvdgfdfdiehnggfgyatmvntfrqyfnqvperkfylsaapqc
iipdaqlsdaifnaafdfiwiqyyntaacsaksfidtslgtfnfdawvtvlkasaskdak
lyvglpasetaanqgyyltpdeveslvstymdrypdtfggimlweatasennqidgapya
dhmkdillh

SCOPe Domain Coordinates for d4tx6a_:

Click to download the PDB-style file with coordinates for d4tx6a_.
(The format of our PDB-style files is described here.)

Timeline for d4tx6a_: