SCOPe 2.04: Domain d4qwob_: 4qwo B:

Lineage for d4qwob_ (4qwo B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.1: Profilin (actin-binding protein) [55770] (2 families)
   alpha-beta(2)-alpha-beta(5)-alpha

5. Family d.110.1.0: automated matches [191571] (1 protein)
   not a true family

6. Protein automated matches [190990] (2 species)
   not a true protein

7. Species Monkeypox virus [TaxId:619591] [258808] (1 PDB entry)

8. Domain d4qwob_: 4qwo B: [258812]
   automated match to d2vk3a_
   complexed with cl, edo, pe8, peg

Details for d4qwob_

PDB Entry: 4qwo, 1.52 Å

PDB Description: 1.52 angstrom crystal structure of a42r profilin-like protein from monkeypox virus zaire-96-i-16

PDB Compounds: (B:) Profilin

SCOPe Domain Sequences for d4qwob_:

Sequence; same for both SEQRES and ATOM records:

>d4qwob_ d.110.1.0 (B:) automated matches {Monkeypox virus [TaxId: 619591]}
aewhkiiedisknnkfedaaivdykttknvlaaipnrtfakinpgeviplitnhnilkpl
igqkfcivytnslmdentyamelltgyapvspiviarthtaliflmgkpttsrrdvyrtc
rdhatrvratgn

Timeline for d4qwob_:

• d4qwob_ is new in SCOPe 2.04-stable
  
• d4qwob_ appears in SCOPe 2.05
  
• d4qwob_ appears in the current release, SCOPe 2.08