Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) |
Family c.56.3.0: automated matches [193325] (1 protein) not a true family |
Protein automated matches [193326] (6 species) not a true protein |
Species Streptococcus pyogenes [TaxId:471876] [257616] (2 PDB entries) |
Domain d4qt4b_: 4qt4 B: [258811] automated match to d4jx9a_ |
PDB Entry: 4qt4 (more details), 2.19 Å
SCOPe Domain Sequences for d4qt4b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qt4b_ c.56.3.0 (B:) automated matches {Streptococcus pyogenes [TaxId: 471876]} mvkmivglgnpgskyektkhnigfmaidnivknldvtftddknfkaqigstfinhekvyf vkpttfmnnsgiavkalltyyniditdliviyddldmevsklrlrskgsagghngiksii ahigtqefnrikvgigrplkgmtvinhvmgqfntedniaisltldrvvnavkfylqendf ektmqkfng
Timeline for d4qt4b_: