Class a: All alpha proteins [46456] (289 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (12 species) |
Species Norway rat (Rattus norvegicus) [TaxId:10116] [158477] (17 PDB entries) |
Domain d4qnhr_: 4qnh R: [258806] Other proteins in same PDB: d4qnhb1, d4qnhb2, d4qnhb3 automated match to d4djca_ complexed with ca, so4 |
PDB Entry: 4qnh (more details), 2.02 Å
SCOPe Domain Sequences for d4qnhr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qnhr_ a.39.1.5 (R:) Calmodulin {Norway rat (Rattus norvegicus) [TaxId: 10116]} dqlteeqiaefkeafslfdkdgdgtittkelgtvmrslgqnpteaelqdminevdadgng tidfpefltmmarkmkdddseeeireafrvfdkdgngyisaaelrhvmtnlgekltdeev demireadidgdgqvnyeefvqmmta
Timeline for d4qnhr_: