Lineage for d4qnhb_ (4qnh B:)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1697000Fold f.15: Small-conductance potassium channel [81328] (1 superfamily)
    oligomeric transmembrane alpha-helical protein
  4. 1697001Superfamily f.15.1: Small-conductance potassium channel [81327] (1 family) (S)
  5. 1697002Family f.15.1.1: Small-conductance potassium channel [81326] (2 proteins)
  6. 1697003Protein Small-conductance potassium channel [64528] (1 species)
  7. 1697004Species Norway rat (Rattus norvegicus) [TaxId:10116] [64529] (3 PDB entries)
  8. 1697006Domain d4qnhb_: 4qnh B: [258803]
    Other proteins in same PDB: d4qnhr_
    automated match to d1kkda_
    complexed with ca, so4

Details for d4qnhb_

PDB Entry: 4qnh (more details), 2.02 Å

PDB Description: Calcium-calmodulin (T79D) complexed with the calmodulin binding domain from a small conductance potassium channel SK2-a
PDB Compounds: (B:) Small conductance calcium-activated potassium channel protein 2

SCOPe Domain Sequences for d4qnhb_:

Sequence, based on SEQRES records: (download)

>d4qnhb_ f.15.1.1 (B:) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
grkleltkaekhvhnfmmdtqltkrvknaaanvlretwliykntklvkkidhakvrkhqr
kflqaihqlrsvkmeqrklndqantlvdlaktqle

Sequence, based on observed residues (ATOM records): (download)

>d4qnhb_ f.15.1.1 (B:) Small-conductance potassium channel {Norway rat (Rattus norvegicus) [TaxId: 10116]}
grkleltkaedtqltkrvknaaanvlretwliykntklvkkidhakvrkhqrkflqaihq
lrsvkmeqrklndqantlvdlaktqle

SCOPe Domain Coordinates for d4qnhb_:

Click to download the PDB-style file with coordinates for d4qnhb_.
(The format of our PDB-style files is described here.)

Timeline for d4qnhb_:

  • d4qnhb_ appears in periodic updates to SCOPe 2.04 starting on 2014-08-07
  • d4qnhb_ appears in SCOPe 2.05
  • d4qnhb_ appears in the current release, SCOPe 2.07, called d4qnhb1