Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins) automatically mapped to Pfam PF00850 |
Protein automated matches [190786] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188039] (20 PDB entries) |
Domain d4qa0b_: 4qa0 B: [258788] automated match to d2v5wb_ complexed with gol, k, shh, zn |
PDB Entry: 4qa0 (more details), 2.24 Å
SCOPe Domain Sequences for d4qa0b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4qa0b_ c.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv ainwsggwhhakkdeasgffylndavlgilrlrrkferilyvdldlhhgdgvedafsfts kvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqicesvlkevyq afnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantar cwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnl khvv
Timeline for d4qa0b_: