Lineage for d4qa2b_ (4qa2 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1599042Fold c.42: Arginase/deacetylase [52767] (1 superfamily)
    3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456
  4. 1599043Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) (S)
  5. 1599321Family c.42.1.2: Histone deacetylase, HDAC [52773] (4 proteins)
    automatically mapped to Pfam PF00850
  6. 1599355Protein automated matches [190786] (1 species)
    not a true protein
  7. 1599356Species Human (Homo sapiens) [TaxId:9606] [188039] (20 PDB entries)
  8. 1599383Domain d4qa2b_: 4qa2 B: [258787]
    automated match to d2v5wb_
    complexed with gol, k, shh, zn

Details for d4qa2b_

PDB Entry: 4qa2 (more details), 2.38 Å

PDB Description: Crystal structure of I243N HDAC8 in complex with SAHA
PDB Compounds: (B:) Histone deacetylase 8

SCOPe Domain Sequences for d4qa2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qa2b_ c.42.1.2 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lvpvyiyspeyvsmcdslakipkrasmvhslieayalhkqmrivkpkvasmeematfhtd
aylqhlqkvsqegdddhpdsieyglgydcpategifdyaaaiggatitaaqclidgmckv
ainwsggwhhakkdeasgfcylndavlgilrlrrkferilyvdldlhhgdgvedafsfts
kvmtvslhkfspgffpgtgdvsdvglgkgryysvnvpiqdgiqdekyyqncesvlkevyq
afnpkavvlqlgadtiagdpmcsfnmtpvgigkclkyilqwqlatlilggggynlantar
cwtyltgvilgktlsseipdhefftaygpdyvleitpscrpdrnephriqqilnyikgnl
khvvi

SCOPe Domain Coordinates for d4qa2b_:

Click to download the PDB-style file with coordinates for d4qa2b_.
(The format of our PDB-style files is described here.)

Timeline for d4qa2b_: