Lineage for d4pkhj_ (4pkh J:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2969655Fold d.109: Gelsolin-like [55752] (3 superfamilies)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2969656Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) (S)
  5. 2969657Family d.109.1.1: Gelsolin-like [55754] (5 proteins)
  6. 2969841Protein automated matches [226883] (2 species)
    not a true protein
  7. 2969842Species Human (Homo sapiens) [TaxId:9606] [225058] (4 PDB entries)
  8. 2969846Domain d4pkhj_: 4pkh J: [258776]
    Other proteins in same PDB: d4pkha1, d4pkha2, d4pkhd1, d4pkhd2, d4pkhf1, d4pkhf2, d4pkhi1, d4pkhi2
    automated match to d1yagg_
    complexed with adp, ca

Details for d4pkhj_

PDB Entry: 4pkh (more details), 2.15 Å

PDB Description: complex of adp-actin with the n-terminal actin-binding domain of tropomodulin
PDB Compounds: (J:) Gelsolin,Tropomodulin-1 chimera

SCOPe Domain Sequences for d4pkhj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pkhj_ d.109.1.1 (J:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mvvehpeflkagkepglqiwrvekfdlvpvptnlygdfftgdayvilktvqlrngnlqyd
lhywlgnecsqdesgaaaiftvqlddylngravqhrevqgfesatflgyfksglkykkgg
vasgfg

SCOPe Domain Coordinates for d4pkhj_:

Click to download the PDB-style file with coordinates for d4pkhj_.
(The format of our PDB-style files is described here.)

Timeline for d4pkhj_: