Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
Domain d4pjfe2: 4pjf E:111-198 [258761] Other proteins in same PDB: d4pjfa1, d4pjfa2, d4pjfb_, d4pjfc1, d4pjfc2, d4pjfd_, d4pjfe1, d4pjff1, d4pjfg1, d4pjfh1 automated match to d2f54d2 complexed with 30w, gol |
PDB Entry: 4pjf (more details), 2.45 Å
SCOPe Domain Sequences for d4pjfe2:
Sequence, based on SEQRES records: (download)
>d4pjfe2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffp
>d4pjfe2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksfacanafnnsiipedtffp
Timeline for d4pjfe2: