SCOPe 2.07: Domain d4pjbf2: 4pjb F:117-238

Lineage for d4pjbf2 (4pjb F:117-238)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (17 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)

8. Domain d4pjbf2: 4pjb F:117-238 [258760]
   Other proteins in same PDB: d4pjba1, d4pjba2, d4pjba3, d4pjbb_, d4pjbc1, d4pjbc2, d4pjbc3, d4pjbd_, d4pjbe1, d4pjbf1, d4pjbg1, d4pjbh1
   automated match to d3of6b2
   complexed with 2lj, gol

Details for d4pjbf2

PDB Entry: 4pjb, 2.85 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait b-f3-c1 tcr

PDB Compounds: (F:) TCR-beta

SCOPe Domain Sequences for d4pjbf2:

Sequence, based on SEQRES records:

>d4pjbf2 b.1.1.2 (F:117-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
ae

Sequence, based on observed residues (ATOM records):

>d4pjbf2 b.1.1.2 (F:117-238) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqrcqvqfyglsendewtqdrakpvtqivsae

Timeline for d4pjbf2:

• d4pjbf2 first appeared in SCOPe 2.04
  
• d4pjbf2 appears in SCOPe 2.06
  
• d4pjbf2 appears in the current release, SCOPe 2.08