Lineage for d4tpiz_ (4tpi Z:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2405549Protein Trypsin(ogen) [50515] (9 species)
  7. 2405567Species Cow (Bos taurus) [TaxId:9913] [50516] (494 PDB entries)
    Uniprot P00760
  8. 2405997Domain d4tpiz_: 4tpi Z: [25876]
    Other proteins in same PDB: d4tpii_
    complexed with ca, so4, val

Details for d4tpiz_

PDB Entry: 4tpi (more details), 2.2 Å

PDB Description: the refined 2.2-angstroms (0.22-nm) x-ray crystal structure of the ternary complex formed by bovine trypsinogen, valine-valine and the arg15 analogue of bovine pancreatic trypsin inhibitor
PDB Compounds: (Z:) trypsinogen

SCOPe Domain Sequences for d4tpiz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tpiz_ b.47.1.2 (Z:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOPe Domain Coordinates for d4tpiz_:

Click to download the PDB-style file with coordinates for d4tpiz_.
(The format of our PDB-style files is described here.)

Timeline for d4tpiz_: