SCOPe 2.03: Domain d4tpiz_: 4tpi Z:

Lineage for d4tpiz_ (4tpi Z:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
   Uniprot P00760

8. Domain d4tpiz_: 4tpi Z: [25876]
   Other proteins in same PDB: d4tpii_
   complexed with ca, so4, val

Details for d4tpiz_

PDB Entry: 4tpi, 2.2 Å

PDB Description: the refined 2.2-angstroms (0.22-nm) x-ray crystal structure of the ternary complex formed by bovine trypsinogen, valine-valine and the arg15 analogue of bovine pancreatic trypsin inhibitor

PDB Compounds: (Z:) trypsinogen

SCOPe Domain Sequences for d4tpiz_:

Sequence; same for both SEQRES and ATOM records:

>d4tpiz_ b.47.1.2 (Z:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d4tpiz_:

• d4tpiz_ first appeared (with stable ids) in SCOP 1.55
  
• d4tpiz_ appears in SCOPe 2.02
  
• d4tpiz_ appears in SCOPe 2.04
  
• d4tpiz_ appears in the current release, SCOPe 2.08