Lineage for d4tpiz_ (4tpi Z:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 111585Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 111670Family b.47.1.2: Eukaryotic proteases [50514] (36 proteins)
  6. 112135Protein Trypsin(ogen) [50515] (7 species)
  7. 112136Species Cow (Bos taurus) [TaxId:9913] [50516] (147 PDB entries)
  8. 112275Domain d4tpiz_: 4tpi Z: [25876]
    Other proteins in same PDB: d4tpii_

Details for d4tpiz_

PDB Entry: 4tpi (more details), 2.2 Å

PDB Description: the refined 2.2-angstroms (0.22-nm) x-ray crystal structure of the ternary complex formed by bovine trypsinogen, valine-valine and the arg15 analogue of bovine pancreatic trypsin inhibitor

SCOP Domain Sequences for d4tpiz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4tpiz_ b.47.1.2 (Z:) Trypsin(ogen) {Cow (Bos taurus)}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

SCOP Domain Coordinates for d4tpiz_:

Click to download the PDB-style file with coordinates for d4tpiz_.
(The format of our PDB-style files is described here.)

Timeline for d4tpiz_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4tpii_