SCOPe 2.06: Domain d4pjfe1: 4pjf E:1-110

Lineage for d4pjfe1 (4pjf E:1-110)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d4pjfe1: 4pjf E:1-110 [258759]
   Other proteins in same PDB: d4pjfa1, d4pjfb1, d4pjfb2, d4pjfc1, d4pjfd_, d4pjfe2, d4pjff2, d4pjfg2, d4pjfh2
   automated match to d2f54d1
   complexed with 30w, gol

Details for d4pjfe1

PDB Entry: 4pjf, 2.45 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait b-c10 tcr

PDB Compounds: (E:) TCR-alpha

SCOPe Domain Sequences for d4pjfe1:

Sequence; same for both SEQRES and ATOM records:

>d4pjfe1 b.1.1.0 (E:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
ssflsrskgysylllkelqmkdsasylcaaedsnyqliwgagtkliikpd

Timeline for d4pjfe1:

• d4pjfe1 first appeared in SCOPe 2.04
  
• d4pjfe1 appears in SCOPe 2.05
  
• d4pjfe1 appears in SCOPe 2.07
  
• d4pjfe1 appears in the current release, SCOPe 2.08