Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (17 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries) |
Domain d4pjbe2: 4pjb E:111-198 [258755] Other proteins in same PDB: d4pjba1, d4pjba2, d4pjba3, d4pjbb_, d4pjbc1, d4pjbc2, d4pjbc3, d4pjbd_, d4pjbe1, d4pjbf1, d4pjbg1, d4pjbh1 automated match to d2f54d2 complexed with 2lj, gol |
PDB Entry: 4pjb (more details), 2.85 Å
SCOPe Domain Sequences for d4pjbe2:
Sequence, based on SEQRES records: (download)
>d4pjbe2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffp
>d4pjbe2 b.1.1.2 (E:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnd facanafnnsiipedtffp
Timeline for d4pjbe2: