SCOPe 2.05: Domain d4pjig2: 4pji G:111-199

Lineage for d4pjig2 (4pji G:111-199)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d4pjig2: 4pji G:111-199 [258744]
   Other proteins in same PDB: d4pjia1, d4pjia2, d4pjib_, d4pjic1, d4pjic2, d4pjid_, d4pjie1, d4pjif1, d4pjig1, d4pjih1
   automated match to d2f54d2
   complexed with 30w, gol, na

Details for d4pjig2

PDB Entry: 4pji, 2.5 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait c-c10 tcr

PDB Compounds: (G:) TCR-alpha

SCOPe Domain Sequences for d4pjig2:

Sequence, based on SEQRES records:

>d4pjig2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d4pjig2 b.1.1.2 (G:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsd
facanafnnsiipedtffps

Timeline for d4pjig2:

• d4pjig2 first appeared in SCOPe 2.04
  
• d4pjig2 appears in SCOPe 2.06
  
• d4pjig2 appears in the current release, SCOPe 2.08