Lineage for d4pjcc1 (4pjc C:1-178)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2182595Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2182596Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2183623Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 2183624Protein automated matches [226842] (4 species)
    not a true protein
  7. 2183637Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries)
  8. 2183690Domain d4pjcc1: 4pjc C:1-178 [258741]
    Other proteins in same PDB: d4pjca2, d4pjca3, d4pjcb_, d4pjcc2, d4pjcc3, d4pjcd_, d4pjce1, d4pjce2, d4pjcf1, d4pjcf2, d4pjcg1, d4pjcg2, d4pjch1, d4pjch2
    automated match to d4l4ta1
    complexed with 2lj, b3p

Details for d4pjcc1

PDB Entry: 4pjc (more details), 2.5 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait c-a11 tcr
PDB Compounds: (C:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d4pjcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4pjcc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

SCOPe Domain Coordinates for d4pjcc1:

Click to download the PDB-style file with coordinates for d4pjcc1.
(The format of our PDB-style files is described here.)

Timeline for d4pjcc1: