Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
Protein automated matches [226842] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [226044] (65 PDB entries) |
Domain d4pjcc1: 4pjc C:1-178 [258741] Other proteins in same PDB: d4pjca2, d4pjca3, d4pjcb_, d4pjcc2, d4pjcc3, d4pjcd_, d4pjce1, d4pjce2, d4pjcf1, d4pjcf2, d4pjcg1, d4pjcg2, d4pjch1, d4pjch2 automated match to d4l4ta1 complexed with 2lj, b3p |
PDB Entry: 4pjc (more details), 2.5 Å
SCOPe Domain Sequences for d4pjcc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4pjcc1 d.19.1.0 (C:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]} rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr
Timeline for d4pjcc1: