Class g: Small proteins [56992] (91 folds) |
Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily) dimetal(zinc)-bound alpha+beta fold |
Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) |
Family g.50.1.0: automated matches [191482] (1 protein) not a true family |
Protein automated matches [190772] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187998] (19 PDB entries) |
Domain d2mnya_: 2mny A: [258688] automated match to d1mm3a_ complexed with zn |
PDB Entry: 2mny (more details)
SCOPe Domain Sequences for d2mnya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mnya_ g.50.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} avdlyvcllcgsgndedrlllcdgcddsyhtfclipplhdvpkgdwrcpkclaqe
Timeline for d2mnya_: