Lineage for d4m1gl1 (4m1g L:1-108)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766659Domain d4m1gl1: 4m1g L:1-108 [258682]
    Other proteins in same PDB: d4m1gl2
    automated match to d1a5fl1
    complexed with so4

Details for d4m1gl1

PDB Entry: 4m1g (more details), 1.6 Å

PDB Description: structure of murine igg2a a27d7-fab in complex with vaccinia antigen a33r at the resolution of 1.6 angstroms
PDB Compounds: (L:) Murine IgG2a A27D7 Light chain Fab domain

SCOPe Domain Sequences for d4m1gl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m1gl1 b.1.1.0 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvltqspttmaaspgekititcsasssissnylhwyqqkpgfspklliyrtsnlasgvp
arfsgsgsgtsysltigtmeaedvatyycqqgssipftfgsgtkleik

SCOPe Domain Coordinates for d4m1gl1:

Click to download the PDB-style file with coordinates for d4m1gl1.
(The format of our PDB-style files is described here.)

Timeline for d4m1gl1: