Lineage for d4m3ka_ (4m3k A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2568473Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
  6. 2569281Protein automated matches [190161] (27 species)
    not a true protein
  7. 2569284Species Bacillus licheniformis [TaxId:1402] [188244] (18 PDB entries)
  8. 2569287Domain d4m3ka_: 4m3k A: [258681]
    Other proteins in same PDB: d4m3kb1, d4m3kb2
    automated match to d2blma_
    complexed with cl

Details for d4m3ka_

PDB Entry: 4m3k (more details), 1.48 Å

PDB Description: Structure of a single domain camelid antibody fragment cAb-H7S in complex with the BlaP beta-lactamase from Bacillus licheniformis
PDB Compounds: (A:) Beta-lactamase

SCOPe Domain Sequences for d4m3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4m3ka_ e.3.1.1 (A:) automated matches {Bacillus licheniformis [TaxId: 1402]}
mkddfakleeqfdaklgifaldtgtnrtvayrpderfafastikaltvgvllqqksiedl
nqritytrddlvnynpitekhvdtgmtlkeladaslrysdnaaqnlilkqiggpeslkke
lrkigdevtnperfepelnevnpgetqdtstaralvtslrafaledpgklpsekrellid
wmkrnttgdaliragvpdgwevadktgaasygtrndiaiiwppkgdpvvlavlssrdkkd
akyddkliaeatkvvmkaln

SCOPe Domain Coordinates for d4m3ka_:

Click to download the PDB-style file with coordinates for d4m3ka_.
(The format of our PDB-style files is described here.)

Timeline for d4m3ka_: