SCOPe 2.08: Domain d4lqfl1: 4lqf L:1-113

Lineage for d4lqfl1 (4lqf L:1-113)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d4lqfl1: 4lqf L:1-113 [258679]
   Other proteins in same PDB: d4lqfl2
   automated match to d1t66c1
   complexed with zn

Details for d4lqfl1

PDB Entry: 4lqf, 2.3 Å

PDB Description: structure of murine igg2b a2c7-fab in complex with vaccinia antigen a33r at the resolution of 2.3 angstroms

PDB Compounds: (L:) Murine IgG2b A2C7 Light chain Fab domain

SCOPe Domain Sequences for d4lqfl1:

Sequence; same for both SEQRES and ATOM records:

>d4lqfl1 b.1.1.1 (L:1-113) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvvmtqtplslpvslgdqasiscrssqslihtngntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthippwtfgggtkleik

Timeline for d4lqfl1:

• d4lqfl1 first appeared in SCOPe 2.04
  
• d4lqfl1 appears in SCOPe 2.07