Lineage for d4lzva_ (4lzv A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1551687Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 1551688Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 1551689Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 1551712Protein beta-Lactoglobulin [50827] (3 species)
  7. 1551713Species Cow (Bos taurus) [TaxId:9913] [50828] (41 PDB entries)
    Uniprot P02754
  8. 1551743Domain d4lzva_: 4lzv A: [258678]
    automated match to d1bsqa_
    complexed with zn

Details for d4lzva_

PDB Entry: 4lzv (more details), 2.44 Å

PDB Description: bovine beta-lactoglobulin crystallized in the presence of 20 mm zinc chloride
PDB Compounds: (A:) beta-lactoglobulin

SCOPe Domain Sequences for d4lzva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lzva_ b.60.1.1 (A:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
tqtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkwen
gecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqclv
rtpevddealekfdkalkalpmhirlsfnptqleeqchi

SCOPe Domain Coordinates for d4lzva_:

Click to download the PDB-style file with coordinates for d4lzva_.
(The format of our PDB-style files is described here.)

Timeline for d4lzva_: