Lineage for d4lyxa_ (4lyx A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1484437Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1484438Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1484439Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1484440Protein (Apo)ferritin [47246] (8 species)
  7. 1484441Species Bullfrog (Rana catesbeiana) [TaxId:8400] [47249] (17 PDB entries)
  8. 1484444Domain d4lyxa_: 4lyx A: [258669]
    automated match to d1mfra_
    complexed with cl, fe, mg

Details for d4lyxa_

PDB Entry: 4lyx (more details), 1.23 Å

PDB Description: five minutes iron loaded frog m ferritin
PDB Compounds: (A:) Ferritin, middle subunit

SCOPe Domain Sequences for d4lyxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lyxa_ a.25.1.1 (A:) (Apo)ferritin {Bullfrog (Rana catesbeiana) [TaxId: 8400]}
vsqvrqnyhsdceaavnrmlnlelyasytyssmyaffdrddvalhnvaeffkehsheere
haekfmkyqnkrggrvvlqdikkperdewgntleamqaalqlektvnqalldlhklatdk
vdphlcdfleseyleeqvkdikrigdfitnlkrlglpengmgeylfdkhsvkes

SCOPe Domain Coordinates for d4lyxa_:

Click to download the PDB-style file with coordinates for d4lyxa_.
(The format of our PDB-style files is described here.)

Timeline for d4lyxa_: