Lineage for d4d09d_ (4d09 D:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1508295Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. 1508296Superfamily a.211.1: HD-domain/PDEase-like [109604] (6 families) (S)
  5. 1508691Family a.211.1.0: automated matches [191566] (1 protein)
    not a true family
  6. 1508692Protein automated matches [190983] (6 species)
    not a true protein
  7. 1508693Species Human (Homo sapiens) [TaxId:9606] [188676] (56 PDB entries)
  8. 1508791Domain d4d09d_: 4d09 D: [258661]
    automated match to d3b2ra_
    complexed with 788, mg, zn

Details for d4d09d_

PDB Entry: 4d09 (more details), 2.5 Å

PDB Description: pde2a catalytic domain in complex with a brain penetrant inhibitor
PDB Compounds: (D:) cgmp-dependent 3', 5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d4d09d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d09d_ a.211.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqpvaaidsnfasftytprslpeddtsmailsmlqdmnfinnykidcptlarfclmvkkg
yrdppyhnwmhafsvshfcyllyknleltnyledieifalfiscmchdldhrgtnnsfqv
asksvlaalyssegsvmerhhfaqaiailnthgcnifdhfsrkdyqrmldlmrdiilatd
lahhlrifkdlqkmaevgydrnnkqhhrlllcllmtscdlsdqtkgwkttrkiaeliyke
ffsqgdlekamgnrpmemmdrekayipelqisfmehiampiykllqdlfpkaaelyerva
snrehwtkvshkftirglpsnnsldf

SCOPe Domain Coordinates for d4d09d_:

Click to download the PDB-style file with coordinates for d4d09d_.
(The format of our PDB-style files is described here.)

Timeline for d4d09d_: