SCOPe 2.03: Domain d1tpae_: 1tpa E:

Lineage for d1tpae_ (1tpa E:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Trypsin(ogen) [50515] (9 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50516] (392 PDB entries)
   Uniprot P00760

8. Domain d1tpae_: 1tpa E: [25864]
   Other proteins in same PDB: d1tpai_
   complexed with ca

Details for d1tpae_

PDB Entry: 1tpa, 1.9 Å

PDB Description: the geometry of the reactive site and of the peptide groups in trypsin, trypsinogen and its complexes with inhibitors

PDB Compounds: (E:) anhydro-trypsin

SCOPe Domain Sequences for d1tpae_:

Sequence; same for both SEQRES and ATOM records:

>d1tpae_ b.47.1.2 (E:) Trypsin(ogen) {Cow (Bos taurus) [TaxId: 9913]}
ivggytcgantvpyqvslnsgyhfcggslinsqwvvsaahcyksgiqvrlgedninvveg
neqfisasksivhpsynsntlnndimliklksaaslnsrvasislptscasagtqclisg
wgntkssgtsypdvlkclkapilsdsscksaypgqitsnmfcagyleggkdscqgdsggp
vvcsgklqgivswgsgcaqknkpgvytkvcnyvswikqtiasn

Timeline for d1tpae_:

• d1tpae_ first appeared (with stable ids) in SCOP 1.55
  
• d1tpae_ appears in SCOPe 2.02
  
• d1tpae_ appears in SCOPe 2.04
  
• d1tpae_ appears in the current release, SCOPe 2.08